Contents
Website Overview
Mysite Rank : #130484

(desktop computer, laptop/notebook, tablet and mobile phone).
Traffic Metrics
How many visits does actividadesdeinfantilyprimaria.com have ?
How does it compare against other websites in the world ?
How many pages are viewed daily ?
Mysite Rank
actividadesdeinfantilyprimaria.com
is ranked #130484 in the world
Unique Visitors
- 3.63 thousands unique visits per day.
- 108.81 thousands monthly unique visitors.
- 2.63% change over the 3 past months.
Page Views
- 9.32 thousands daily page views.
- 279.65 thousands monthly page views.
- 2.63% change over the 3 past months.
Traffic By Visitors Country
Alternative Sites
What are actividadesdeinfantilyprimaria.com main competitors ?
Find actividadesdeinfantilyprimaria.com similar websites in 2021
Main competitors
Hosting Locations
Where is this website located ?
What is the ip address of actividadesdeinfantilyprimaria.com ?
Which country does it belong to ?
- 4 web hosting service in Spain (ES) :
- Madrid : 1 server provided by OVH SAS
Check the IP address details on the map (1 IP)
- Madrid : 1 server provided by OVH SAS
Metas Tags
What is the title of this website homepage ?
Does actividadesdeinfantilyprimaria.com use meta tags ?
Title tag
Actividades de infantil y primaria – Recursos para trabajar en infantil y primariaMetas tags
Meta-description
Recursos para trabajar en infantil y primariaMeta-keywords
Website Age Estimation
When was actividadesdeinfantilyprimaria.com domain first registered ?
How old is this website ?
Domain WHOIS lookup
Internet Archive History
Search Engine Metrics
Is actividadesdeinfantilyprimaria.com visible on search engines results pages (SERP) ?
How many pages are displayed from this website ?
How many sites link back to it ?
What is this domain authority ?
Search engines results pages (SERP)
Maximum result count is of 275K on one of the main SERP.
This website has a strong presence on major search websites.
Total backlinks
from all websites and all pages
linking into actividadesdeinfantilyprimaria.com
This website has 9.7 thousands backlinks.
Unique domains backlinks
linking in.
This website has 41 unique domains backlinks.
Domain Authority
with a mark of 35 out of 100.
Page Authority
with a mark of 32 out of 100
Income and Valuation Estimates
What is this site worth ?
How much does this site earn with advertising ?
Estimated revenue from ads
* Estimated figures based upon a theoretical revenue from ads.
Estimated website valuation
* Estimated figures based upon a theoretical revenue from ads.
Frequently Asked Questions
In the below section you will find all the most popular questions about this website.
What is actividadesdeinfantilyprimaria.com ?
actividadesdeinfantilyprimaria.com is the worldwide known website or portal of ACTIVIDADESDEINFANTILYPRIMARIA
How old is actividadesdeinfantilyprimaria.com site ?
The domain name ACTIVIDADESDEINFANTILYPRIMARIA.COM was registered 10 years, 3 months, 23 days ago (2015-03-19).
We have found live activity from the website dated 8 years, 2 months, 0 days ago (2017-05-12).
Where are actividadesdeinfantilyprimaria.com visitors from ?
Visitors are known to be mainly located in : Mexico, Peru, Spain, Argentina, Colombia, Chile.
Is actividadesdeinfantilyprimaria.com a high-traffic site ?
Yes! actividadesdeinfantilyprimaria.com is one of the strongest website in the world. We have computed a Mysite Rank of #130484. It receives every day nearly 3.63 thousands unique visitors from all around the world.
Is actividadesdeinfantilyprimaria.com trustworthy ?
Yes. This website has not been reported as scam or malicious.
Who visits this site ?
Our traffic statistics on actividadesdeinfantilyprimaria.com show that the major percentage of visitors is from Mexico.
Recently added websites
Find updated metrics on the recently analysed websites below