Website Overview

Mysite Rank : #128909

How does actividadesdeinfantilyprimaria.com look with a desktop computer, a laptop, a tablet and a mobile phone ?
actividadesdeinfantilyprimaria.com favicon actividadesdeinfantilyprimaria.com home page screenshots as seen on various devices
(desktop computer, laptop/notebook, tablet and mobile phone).

Traffic Metrics

How many visits does actividadesdeinfantilyprimaria.com have ?
How does it compare against other websites in the world ?
How many pages are viewed daily ?

Mysite Rank

#128909

actividadesdeinfantilyprimaria.com
is ranked #128909 in the world

Unique Visitors

108.81K
  +2.63%
  • 3.63 thousands unique visits per day.
  • 108.81 thousands monthly unique visitors.
  • 2.63% change over the 3 past months.




Page Views

279.65K
  -26.01%
  • 9.32 thousands daily page views.
  • 279.65 thousands monthly page views.
  • 2.63% change over the 3 past months.




Traffic By Visitors Country


 
Total of Monthly Visits
% of Website Traffic

MexicoMexico27%
29.09K

PeruPeru19%
20.78K

SpainSpain17%
18.34K

ArgentinaArgentina16%
16.87K

ColombiaColombia12%
12.86K

ChileChile10%
11.39K

Alternative Sites

What are actividadesdeinfantilyprimaria.com main competitors ?
Find actividadesdeinfantilyprimaria.com similar websites in 2021

Main competitors

Hosting Locations

Where is this website located ?
What is the ip address of actividadesdeinfantilyprimaria.com ?
Which country does it belong to ?

Global Map



actividadesdeinfantilyprimaria.com is hosted in 1 country :

Metas Tags

What is the title of this website homepage ?
Does actividadesdeinfantilyprimaria.com use meta tags ?

Title tag

Actividades de infantil y primaria – Recursos para trabajar en infantil y primaria

Metas tags

Meta-description

Recursos para trabajar en infantil y primaria

Meta-keywords


Website Age Estimation

When was actividadesdeinfantilyprimaria.com domain first registered ?
How old is this website ?

Domain WHOIS lookup

  • Domain First Registration: March 19, 2015
  • Domain Age: 6 years, 7 months, 0 days

Internet Archive History

  • First snapshots : May 12, 2017
  • Estimated age : 4 years, 5 months, 7 days

Search Engine Metrics

Is actividadesdeinfantilyprimaria.com visible on search engines results pages (SERP) ?
How many pages are displayed from this website ?
How many sites link back to it ?
What is this domain authority ?

Search engines results pages (SERP)

68.5K Min 171.75K Avg Max 275K
As of now, actividadesdeinfantilyprimaria.com has 171.75K results in the Search Engines Results Pages.
Maximum result count is of 275K on one of the main SERP.
This website has a strong presence on major search websites.

Total backlinks

9.7K

This number shows the total number of backlinks
from all websites and all pages
linking into actividadesdeinfantilyprimaria.com
This website has 9.7 thousands backlinks.

Unique domains backlinks

41

This figure sums up the total number of distinct domains
linking in.
This website has 41 unique domains backlinks.


Domain Authority

35 / 100

actividadesdeinfantilyprimaria.com is established as a high domain and website authority,
with a mark of 35 out of 100.

Page Authority

32 / 100

The Home page (or index url) has a strong domain authority,
with a mark of 32 out of 100

Income and Valuation Estimates

What is this site worth ?
How much does this site earn with advertising ?

Estimated revenue from ads

$505
  -26.06%
  • 17 US dollars per day from advertising.
  • 505 USD earned monthly from advertising.
  • -26.06% change over the 3 past months.
    * Estimated figures based upon a theoretical revenue from ads.
  • Estimated website valuation

    $9.09K
      -26.06%
  • This site is estimated at 9.09 thousands US dollars, based upon its current estimated advertising cashflows
  • -26.06% change over the 3 past months.
    * Estimated figures based upon a theoretical revenue from ads.
  • Frequently Asked Questions

    In the below section you will find all the most popular questions about this website.

    What is actividadesdeinfantilyprimaria.com ?
    actividadesdeinfantilyprimaria.com is the worldwide known website or portal of ACTIVIDADESDEINFANTILYPRIMARIA

    How old is actividadesdeinfantilyprimaria.com site ?
    The domain name ACTIVIDADESDEINFANTILYPRIMARIA.COM was registered 6 years, 7 months, 0 days ago (2015-03-19).
    We have found live activity from the website dated 4 years, 5 months, 7 days ago (2017-05-12).

    Where are actividadesdeinfantilyprimaria.com visitors from ?
    Visitors are known to be mainly located in : Mexico, Peru, Spain, Argentina, Colombia, Chile.

    Is actividadesdeinfantilyprimaria.com a high-traffic site ?
    Yes! actividadesdeinfantilyprimaria.com is one of the strongest website in the world. We have computed a Mysite Rank of #128909. It receives every day nearly 3.63 thousands unique visitors from all around the world.

    Is actividadesdeinfantilyprimaria.com trustworthy ?
    Yes. This website has not been reported as scam or malicious.

    Who visits this site ?
    Our traffic statistics on actividadesdeinfantilyprimaria.com show that the major percentage of visitors is from Mexico.

    Recently added websites

    Find updated metrics on the recently analysed websites below